Recombinant Human AZIN1 protein, GST-tagged
Cat.No. : | AZIN1-8965H |
Product Overview : | Recombinant Human AZIN1 protein(330-448 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 330-448 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | EDLNTIPEVHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGITSDSMMKNFFFVPSCIQLSQEDSFSAEA |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | AZIN1 antizyme inhibitor 1 [ Homo sapiens ] |
Official Symbol | AZIN1 |
Synonyms | AZIN1; antizyme inhibitor 1; OAZIN, ornithine decarboxylase antizyme inhibitor; OAZI; ODC1L; ornithine decarboxylase 1 like; AZI; ornithine decarboxylase antizyme inhibitor; OAZIN; MGC691; MGC3832; |
mRNA Refseq | NM_015878 |
Protein Refseq | NP_056962 |
MIM | 607909 |
UniProt ID | O14977 |
Gene ID | 51582 |
◆ Recombinant Proteins | ||
AZIN1-8965H | Recombinant Human AZIN1 protein, GST-tagged | +Inquiry |
AZIN1-10090H | Recombinant Human AZIN1, GST-tagged | +Inquiry |
AZIN1-01H | Recombinant Human AZIN1 Protein, 1-448, C-IgG1 Fc-Avi-tagged, Biotinylated | +Inquiry |
AZIN1-0708H | Recombinant Human AZIN1 Protein (Ile5-Lys290), His tagged | +Inquiry |
AZIN1-3628H | Recombinant Human AZIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AZIN1-8551HCL | Recombinant Human AZIN1 293 Cell Lysate | +Inquiry |
AZIN1-8552HCL | Recombinant Human AZIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AZIN1 Products
Required fields are marked with *
My Review for All AZIN1 Products
Required fields are marked with *
0
Inquiry Basket