Recombinant Human AZIN1 protein, His-tagged
| Cat.No. : | AZIN1-8966H |
| Product Overview : | Recombinant Human AZIN1 protein(330-448 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 330-448 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | EDLNTIPEVHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGITSDSMMKNFFFVPSCIQLSQEDSFSAEA |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | AZIN1 antizyme inhibitor 1 [ Homo sapiens ] |
| Official Symbol | AZIN1 |
| Synonyms | AZIN1; antizyme inhibitor 1; OAZIN, ornithine decarboxylase antizyme inhibitor; OAZI; ODC1L; ornithine decarboxylase 1 like; AZI; ornithine decarboxylase antizyme inhibitor; OAZIN; MGC691; MGC3832; |
| mRNA Refseq | NM_015878 |
| Protein Refseq | NP_056962 |
| MIM | 607909 |
| UniProt ID | O14977 |
| Gene ID | 51582 |
| ◆ Recombinant Proteins | ||
| AZIN1-1291HF | Recombinant Full Length Human AZIN1 Protein, GST-tagged | +Inquiry |
| AZIN1-1869C | Recombinant Chicken AZIN1 | +Inquiry |
| AZIN1-533H | Recombinant Human AZIN1 Protein, His-tagged | +Inquiry |
| AZIN1-0708H | Recombinant Human AZIN1 Protein (Ile5-Lys290), His tagged | +Inquiry |
| Azin1-534R | Recombinant Rat Azin1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AZIN1-8551HCL | Recombinant Human AZIN1 293 Cell Lysate | +Inquiry |
| AZIN1-8552HCL | Recombinant Human AZIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AZIN1 Products
Required fields are marked with *
My Review for All AZIN1 Products
Required fields are marked with *



