Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | B3GALT5-1967H |
| Product Overview : | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149363) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. |
| Molecular Mass : | 36.2 kDa |
| AA Sequence : | MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | B3GALT5 beta-1,3-galactosyltransferase 5 [ Homo sapiens (human) ] |
| Official Symbol | B3GALT5 |
| Synonyms | B3GALT5; beta-1,3-galactosyltransferase 5; B3T5; GLCT5; B3GalTx; B3GalT-V; beta3Gal-T5; beta-3-Gx-T5; beta-1,3-GalTase 5; beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5; homolog of C. elegans Bt toxin resistance gene bre-5; EC 2.4.1.- |
| Gene ID | 10317 |
| mRNA Refseq | NM_033173 |
| Protein Refseq | NP_149363 |
| MIM | 604066 |
| UniProt ID | Q9Y2C3 |
| ◆ Recombinant Proteins | ||
| B3GALT5-925M | Recombinant Mouse B3GALT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| B3GALT5-2204H | Recombinant Human B3GALT5 Protein, MYC/DDK-tagged | +Inquiry |
| B3GALT5-227H | Recombinant Human B3GALT5, Fc-tagged | +Inquiry |
| B3GALT5-2221H | Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| B3galt5-1800M | Recombinant Mouse B3galt5 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B3GALT5-001HCL | Recombinant Human B3GALT5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GALT5 Products
Required fields are marked with *
My Review for All B3GALT5 Products
Required fields are marked with *
