Recombinant Human B3GALTL protein, GST-tagged

Cat.No. : B3GALTL-10098H
Product Overview : Recombinant Human B3GALTL protein(199-498 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability July 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 199-498 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : KLTKRLKSESLKSDFTIDLKHEIALYIWDKGGGPPLTPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRMPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDDDTLISISRLQHLLSCYDSGKPVFLGERYGYGLGTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name B3GALTL beta 1,3-galactosyltransferase-like [ Homo sapiens ]
Official Symbol B3GALTL
Synonyms B3GALTL; beta 1,3-galactosyltransferase-like; beta-1,3-glucosyltransferase; B3Glc T; B3GTL; beta 3-glycosyltransferase-like; beta-3-glycosyltransferase-like; UDP-GAL:beta-GlcNAc beta-1,3-galactosyltransferase-like; Gal-T; B3GLCT; B3Glc-T; beta3Glc-T;
Gene ID 145173
mRNA Refseq NM_194318
Protein Refseq NP_919299
MIM 610308
UniProt ID Q6Y288

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B3GALTL Products

Required fields are marked with *

My Review for All B3GALTL Products

Required fields are marked with *

0
cart-icon