Recombinant Human B3GALTL protein, GST-tagged

• Cat.No.: B3GALTL-10098H
• Product Overview: Recombinant Human B3GALTL protein(199-498 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 199-498 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: KLTKRLKSESLKSDFTIDLKHEIALYIWDKGGGPPLTPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRMPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDDDTLISISRLQHLLSCYDSGKPVFLGERYGYGLGTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: B3GALTL beta 1,3-galactosyltransferase-like [ Homo sapiens ]
• Official Symbol: B3GALTL
• Synonyms: B3GALTL; beta 1,3-galactosyltransferase-like; beta-1,3-glucosyltransferase; B3Glc T; B3GTL; beta 3-glycosyltransferase-like; beta-3-glycosyltransferase-like; UDP-GAL:beta-GlcNAc beta-1,3-galactosyltransferase-like; Gal-T; B3GLCT; B3Glc-T; beta3Glc-T
• Gene ID: 145173
• mRNA Refseq: NM_194318
• Protein Refseq: NP_919299
• MIM: 610308
• UniProt ID: Q6Y288