Recombinant Human B3GAT1 protein, GST-tagged
| Cat.No. : | B3GAT1-014H |
| Product Overview : | Human B3GAT1 partial ORF ( NP_061114, 235 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized. [provided by RefSeq] |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | B3GAT1 beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P) [ Homo sapiens ] |
| Official Symbol | B3GAT1 |
| Synonyms | B3GAT1; beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P); CD57, CD57 antigen , LEU7; galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1; GlcAT P; HNK 1; NK 1; glcUAT-P; LEU7 antigen; glucuronosyltransferase P; UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase; NK1; CD57; HNK1; LEU7; NK-1; GLCATP; GLCUATP; |
| Gene ID | 27087 |
| mRNA Refseq | NM_018644 |
| Protein Refseq | NP_061114 |
| MIM | 151290 |
| UniProt ID | Q9P2W7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GAT1 Products
Required fields are marked with *
My Review for All B3GAT1 Products
Required fields are marked with *
