Recombinant Human B4GAT1 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human B4GAT1 protein, GST-tagged

Recombinant Human B4GAT1 protein, GST-tagged

B4GAT1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : B4GAT1-038H
Product Overview : Human B4GAT1 partial ORF ( NP_006867.1, 316 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Figure :

Gene Name : B4GAT1 beta-1,4-glucuronyltransferase 1 [ Homo sapiens (human) ]
Official Symbol : B4GAT1
Synonyms : iGAT; iGNT; B3GNT1; B3GNT6; B3GN-T1; MDDGA13; BETA3GNTI
Gene ID : 11041
mRNA Refseq : NM_006876
Protein Refseq : NP_006867.1
MIM : 605517
UniProt ID : O43505.1

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.