Recombinant Human B4GAT1 protein, GST-tagged
Cat.No. : | B4GAT1-038H |
Product Overview : | Human B4GAT1 partial ORF ( NP_006867.1, 316 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | B4GAT1 beta-1,4-glucuronyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | B4GAT1 |
Synonyms | iGAT; iGNT; B3GNT1; B3GNT6; B3GN-T1; MDDGA13; BETA3GNTI |
Gene ID | 11041 |
mRNA Refseq | NM_006876 |
Protein Refseq | NP_006867.1 |
MIM | 605517 |
UniProt ID | O43505.1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B4GAT1 Products
Required fields are marked with *
My Review for All B4GAT1 Products
Required fields are marked with *
0
Inquiry Basket