Recombinant Human B4GAT1 protein, GST-tagged

Cat.No. : B4GAT1-038H
Product Overview : Human B4GAT1 partial ORF ( NP_006867.1, 316 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name B4GAT1 beta-1,4-glucuronyltransferase 1 [ Homo sapiens (human) ]
Official Symbol B4GAT1
Synonyms iGAT; iGNT; B3GNT1; B3GNT6; B3GN-T1; MDDGA13; BETA3GNTI
Gene ID 11041
mRNA Refseq NM_006876
Protein Refseq NP_006867.1
MIM 605517
UniProt ID O43505.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B4GAT1 Products

Required fields are marked with *

My Review for All B4GAT1 Products

Required fields are marked with *

0
cart-icon