Recombinant Human B4GAT1 protein, GST-tagged

• Cat.No.: B4GAT1-038H
• Product Overview: Human B4GAT1 partial ORF ( NP_006867.1, 316 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. [provided by RefSeq
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: B4GAT1 beta-1,4-glucuronyltransferase 1 [ Homo sapiens (human) ]
• Official Symbol: B4GAT1
• Synonyms: iGAT; iGNT; B3GNT1; B3GNT6; B3GN-T1; MDDGA13; BETA3GNTI
• Gene ID: 11041
• mRNA Refseq: NM_006876
• Protein Refseq: NP_006867.1
• MIM: 605517
• UniProt ID: O43505.1