Recombinant Human BABAM1 protein, GST-tagged

Cat.No. : BABAM1-1853H
Product Overview : Recombinant Human BABAM1 protein(7-143 aa), fused to GST tag, was expressed in E. coli.
Availability November 26, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 7-143 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : SSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDKSHE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name BABAM1 BRISC and BRCA1 A complex member 1 [ Homo sapiens ]
Official Symbol BABAM1
Synonyms BABAM1; BRISC and BRCA1 A complex member 1; C19orf62, chromosome 19 open reading frame 62; BRISC and BRCA1-A complex member 1; FLJ20571; HSPC142; Mediator of Rap80 Interactions and Targeting 40 kD; MERIT40; NBA1; new component of the BRCA1 A complex; BRCA1-A complex subunit MERIT40; new component of the BRCA1-A complex; new component of the BRCAA1 A complex; mediator of Rap80 interactions and targeting 40 kDa; mediator of RAP80 interactions and targeting subunit of 40 kDa; C19orf62;
Gene ID 29086
mRNA Refseq NM_001033549
Protein Refseq NP_001028721
MIM 612766
UniProt ID Q9NWV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BABAM1 Products

Required fields are marked with *

My Review for All BABAM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon