Recombinant Human BABAM1 protein, GST-tagged

• Cat.No.: BABAM1-1853H
• Product Overview: Recombinant Human BABAM1 protein(7-143 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 7-143 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: SSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDKSHE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BABAM1 BRISC and BRCA1 A complex member 1 [ Homo sapiens ]
• Official Symbol: BABAM1
• Synonyms: BABAM1; BRISC and BRCA1 A complex member 1; C19orf62, chromosome 19 open reading frame 62; BRISC and BRCA1-A complex member 1; FLJ20571; HSPC142; Mediator of Rap80 Interactions and Targeting 40 kD; MERIT40; NBA1; new component of the BRCA1 A complex; BRCA1-A complex subunit MERIT40; new component of the BRCA1-A complex; new component of the BRCAA1 A complex; mediator of Rap80 interactions and targeting 40 kDa; mediator of RAP80 interactions and targeting subunit of 40 kDa; C19orf62
• Gene ID: 29086
• mRNA Refseq: NM_001033549
• Protein Refseq: NP_001028721
• MIM: 612766
• UniProt ID: Q9NWV8