Recombinant Human BAIAP2L2 protein, GST-tagged
Cat.No. : | BAIAP2L2-065H |
Product Overview : | Human BAIAP2L2 full-length ORF ( AAH15619.1, 1 a.a. - 518 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 84.1 kDa |
AA Sequence : | MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAIAP2L2 BAI1-associated protein 2-like 2 [ Homo sapiens ] |
Official Symbol | BAIAP2L2 |
Synonyms | BAIAP2L2; BAI1-associated protein 2-like 2; brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2; FLJ22582; pinkbar; BAI1-associated protein 2-like protein 2; planar intestinal- and kidney-specific BAR domain protein; |
Gene ID | 80115 |
mRNA Refseq | NM_025045 |
Protein Refseq | NP_079321 |
UniProt ID | Q6UXY1 |
◆ Recombinant Proteins | ||
BAIAP2L2-10132H | Recombinant Human BAIAP2L2, His-tagged | +Inquiry |
BAIAP2L2-065H | Recombinant Human BAIAP2L2 protein, GST-tagged | +Inquiry |
BAIAP2L2-2282M | Recombinant Mouse BAIAP2L2 Protein | +Inquiry |
BAIAP2L2-958M | Recombinant Mouse BAIAP2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAIAP2L2-1808HF | Recombinant Full Length Human BAIAP2L2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAIAP2L2 Products
Required fields are marked with *
My Review for All BAIAP2L2 Products
Required fields are marked with *
0
Inquiry Basket