Recombinant Human BAIAP2L2 protein, GST-tagged
| Cat.No. : | BAIAP2L2-065H |
| Product Overview : | Human BAIAP2L2 full-length ORF ( AAH15619.1, 1 a.a. - 518 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 84.1 kDa |
| AA Sequence : | MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BAIAP2L2 BAI1-associated protein 2-like 2 [ Homo sapiens ] |
| Official Symbol | BAIAP2L2 |
| Synonyms | BAIAP2L2; BAI1-associated protein 2-like 2; brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2; FLJ22582; pinkbar; BAI1-associated protein 2-like protein 2; planar intestinal- and kidney-specific BAR domain protein; |
| Gene ID | 80115 |
| mRNA Refseq | NM_025045 |
| Protein Refseq | NP_079321 |
| UniProt ID | Q6UXY1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAIAP2L2 Products
Required fields are marked with *
My Review for All BAIAP2L2 Products
Required fields are marked with *



