Recombinant Human BAMBI protein, GST-tagged
| Cat.No. : | BAMBI-067H |
| Product Overview : | Human BAMBI full-length ORF ( AAH19252, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 54.34 kDa |
| AA Sequence : | MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ] |
| Official Symbol | BAMBI |
| Synonyms | BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA; |
| Gene ID | 25805 |
| mRNA Refseq | NM_012342 |
| Protein Refseq | NP_036474 |
| MIM | 604444 |
| UniProt ID | Q13145 |
| ◆ Recombinant Proteins | ||
| BAMBI-0134H | Recombinant Human BAMBI Protein (Val21-Ala152), C-His-tagged | +Inquiry |
| BAMBI-1809HF | Recombinant Full Length Human BAMBI Protein, GST-tagged | +Inquiry |
| BAMBI-3192H | Recombinant Human BAMBI protein, His-tagged | +Inquiry |
| BAMBI-595R | Recombinant Rat BAMBI Protein, His (Fc)-Avi-tagged | +Inquiry |
| BAMBI-067H | Recombinant Human BAMBI protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BAMBI-1332MCL | Recombinant Mouse BAMBI cell lysate | +Inquiry |
| BAMBI-2393HCL | Recombinant Human BAMBI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAMBI Products
Required fields are marked with *
My Review for All BAMBI Products
Required fields are marked with *
