Recombinant Human BAMBI protein, T7/His-tagged
Cat.No. : | BAMBI-75H |
Product Overview : | Recombinant human BAMBI cDNA (21 – 152 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 21-152 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLT HGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQE LTSSKELWFRA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro BAMBI protein mediated Wnt / b-catenin pathway regulation for either adipocytes or hepatocytes differentiation study with this protein as either coating matrix protein or soluble factor.2. May be used for BAMBI protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | BAMBI |
Synonyms | BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA; |
Gene ID | 25805 |
mRNA Refseq | NM_012342 |
Protein Refseq | NP_036474 |
MIM | 604444 |
UniProt ID | Q13145 |
Chromosome Location | 10p12.3-p11.2 |
Pathway | BMP receptor signaling, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem; |
Function | frizzled binding; type II transforming growth factor beta receptor binding; |
◆ Recombinant Proteins | ||
BAMBI-4133C | Recombinant Chicken BAMBI | +Inquiry |
Bambi-8686M | Recombinant Mouse Bambi protein, hFc-tagged | +Inquiry |
BAMBI-75H | Recombinant Human BAMBI protein, T7/His-tagged | +Inquiry |
BAMBI-6754H | Recombinant Human BAMBI protein, hFc-tagged | +Inquiry |
BAMBI-0134H | Recombinant Human BAMBI Protein (Val21-Ala152), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAMBI-1332MCL | Recombinant Mouse BAMBI cell lysate | +Inquiry |
BAMBI-2393HCL | Recombinant Human BAMBI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAMBI Products
Required fields are marked with *
My Review for All BAMBI Products
Required fields are marked with *
0
Inquiry Basket