Recombinant Human BAMBI protein, T7/His-tagged

• Cat.No.: BAMBI-75H
• Product Overview: Recombinant human BAMBI cDNA (21 – 152 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 21-152 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLT HGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQE LTSSKELWFRA
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro BAMBI protein mediated Wnt / b-catenin pathway regulation for either adipocytes or hepatocytes differentiation study with this protein as either coating matrix protein or soluble factor.2. May be used for BAMBI protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: BAMBI
• Synonyms: BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA
• Gene ID: 25805
• mRNA Refseq: NM_012342
• Protein Refseq: NP_036474
• MIM: 604444
• UniProt ID: Q13145
• Chromosome Location: 10p12.3-p11.2
• Pathway: BMP receptor signaling, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem
• Function: frizzled binding; type II transforming growth factor beta receptor binding