Recombinant Human BANF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BANF1-5639H
• Product Overview: BANF1 MS Standard C13 and N15-labeled recombinant protein (NP_003851) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.
• Molecular Mass: 10.1 kDa
• AA Sequence: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BANF1 barrier to autointegration factor 1 [ Homo sapiens (human) ]
• Official Symbol: BANF1
• Synonyms: BANF1; barrier to autointegration factor 1; barrier-to-autointegration factor; BAF; breakpoint cluster region protein 1; NGPS; BCRP1; D14S1460; MGC111161
• Gene ID: 8815
• mRNA Refseq: NM_003860
• Protein Refseq: NP_003851
• MIM: 603811
• UniProt ID: O75531