Recombinant Human BARD1 protein, His-tagged

Cat.No. : BARD1-228H
Product Overview : Recombinant Human BARD1 protein(NP_000456)(428-777 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 428-777 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : GETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name BARD1 BRCA1 associated RING domain 1 [ Homo sapiens ]
Official Symbol BARD1
Synonyms BARD1; BRCA1 associated RING domain 1; BRCA1-associated RING domain protein 1; BARD-1; BRCA1-associated RING domain gene 1; BRCA1 associated RING domain 1 isoform eta; BRCA1 associated RING domain 1 isoform phi; BRCA1 associated RING domain 1 isoform alfa; BRCA1 associated RING domain 1 isoform beta; BRCA1 associated RING domain 1 isoform delta; BRCA1 associated RING domain 1 isoform gamma; BRCA1 associated RING domain 1 isoform epsilon;
Gene ID 580
mRNA Refseq NM_000465
Protein Refseq NP_000456
MIM 601593
UniProt ID Q99728

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BARD1 Products

Required fields are marked with *

My Review for All BARD1 Products

Required fields are marked with *

0
cart-icon