Recombinant Human BARD1 protein, His-tagged
| Cat.No. : | BARD1-228H |
| Product Overview : | Recombinant Human BARD1 protein(NP_000456)(428-777 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 428-777 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | GETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BARD1 BRCA1 associated RING domain 1 [ Homo sapiens ] |
| Official Symbol | BARD1 |
| Synonyms | BARD1; BRCA1 associated RING domain 1; BRCA1-associated RING domain protein 1; BARD-1; BRCA1-associated RING domain gene 1; BRCA1 associated RING domain 1 isoform eta; BRCA1 associated RING domain 1 isoform phi; BRCA1 associated RING domain 1 isoform alfa; BRCA1 associated RING domain 1 isoform beta; BRCA1 associated RING domain 1 isoform delta; BRCA1 associated RING domain 1 isoform gamma; BRCA1 associated RING domain 1 isoform epsilon; |
| Gene ID | 580 |
| mRNA Refseq | NM_000465 |
| Protein Refseq | NP_000456 |
| MIM | 601593 |
| UniProt ID | Q99728 |
| ◆ Recombinant Proteins | ||
| BARD1-598R | Recombinant Rat BARD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BARD1-2291M | Recombinant Mouse BARD1 Protein | +Inquiry |
| BARD1-940R | Recombinant Rat BARD1 Protein | +Inquiry |
| BARD1-074H | Recombinant Human BARD1 protein, GST-tagged | +Inquiry |
| BARD1-26645TH | Recombinant Human BARD1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BARD1 Products
Required fields are marked with *
My Review for All BARD1 Products
Required fields are marked with *
