Recombinant Human BATF3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | BATF3-2261H |
| Product Overview : | BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription. |
| Molecular Mass : | 14.5 kDa |
| AA Sequence : | MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | BATF3 basic leucine zipper ATF-like transcription factor 3 [ Homo sapiens (human) ] |
| Official Symbol | BATF3 |
| Synonyms | BATF3; basic leucine zipper transcription factor, ATF-like 3; basic leucine zipper transcriptional factor ATF-like 3; JDP1; Jun dimerization protein 1; JUNDM1; SNFT; B-ATF-3; Jun dimerization protein p21SNFT; 21-kD small nuclear factor isolated from T cells; 21 kDa small nuclear factor isolated from T-cells; FLJ36352; FLJ37535; |
| Gene ID | 55509 |
| mRNA Refseq | NM_018664 |
| Protein Refseq | NP_061134 |
| MIM | 612470 |
| UniProt ID | Q9NR55 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BATF3 Products
Required fields are marked with *
My Review for All BATF3 Products
Required fields are marked with *



