Recombinant Human BATF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BATF3-2261H
Product Overview : BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
Molecular Mass : 14.5 kDa
AA Sequence : MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BATF3 basic leucine zipper ATF-like transcription factor 3 [ Homo sapiens (human) ]
Official Symbol BATF3
Synonyms BATF3; basic leucine zipper transcription factor, ATF-like 3; basic leucine zipper transcriptional factor ATF-like 3; JDP1; Jun dimerization protein 1; JUNDM1; SNFT; B-ATF-3; Jun dimerization protein p21SNFT; 21-kD small nuclear factor isolated from T cells; 21 kDa small nuclear factor isolated from T-cells; FLJ36352; FLJ37535;
Gene ID 55509
mRNA Refseq NM_018664
Protein Refseq NP_061134
MIM 612470
UniProt ID Q9NR55

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BATF3 Products

Required fields are marked with *

My Review for All BATF3 Products

Required fields are marked with *

0
cart-icon