Recombinant Human BBOX1 protein(1-387aa), His&Myc-tagged
| Cat.No. : | BBOX1-1049H |
| Product Overview : | Recombinant Human BBOX1 protein(O75936)(1-387aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-387aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN |
| Gene Name | BBOX1 butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 [ Homo sapiens ] |
| Official Symbol | BBOX1 |
| Synonyms | BBOX1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; BBOX; gamma-butyrobetaine dioxygenase; BBH; G BBH; gamma BBH; gamma-butyrobetaine hydroxylase; gamma-butyrobetaine,2-oxoglutarate dioxygenase 1; G-BBH; gamma-BBH; |
| Gene ID | 8424 |
| mRNA Refseq | NM_003986 |
| Protein Refseq | NP_003977 |
| MIM | 603312 |
| UniProt ID | O75936 |
| ◆ Recombinant Proteins | ||
| BBOX1-1049H | Recombinant Human BBOX1 protein(1-387aa), His&Myc-tagged | +Inquiry |
| BBOX1-2378H | Recombinant Human BBOX1 Protein, MYC/DDK-tagged | +Inquiry |
| BBOX1-280H | Recombinant Human BBOX1, His-GST tagged | +Inquiry |
| BBOX1-1581HF | Recombinant Full Length Human BBOX1 Protein, GST-tagged | +Inquiry |
| BBOX1-947R | Recombinant Rat BBOX1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBOX1 Products
Required fields are marked with *
My Review for All BBOX1 Products
Required fields are marked with *
