Recombinant Human BCAM Protein, GST-tagged
Cat.No. : | BCAM-113H |
Product Overview : | Human BCAM partial ORF ( NP_005572, 32 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ] |
Official Symbol | BCAM |
Synonyms | BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239; F8/G253 antigen; lutheran antigen; Auberger b antigen; glycoprotein 95kDa; B-cell adhesion molecule; B-CAM cell surface glycoprotein; lutheran blood group glycoprotein; antigen identified by monoclonal F8; basal cell adhesion molecule (Lu and Au blood groups); AU; LU; MSK19; |
Gene ID | 4059 |
mRNA Refseq | NM_001013257 |
Protein Refseq | NP_001013275 |
MIM | 612773 |
UniProt ID | P50895 |
◆ Recombinant Proteins | ||
Bcam-6870M | Active Recombinant Mouse Bcam protein(Met1-Ala541), His-tagged | +Inquiry |
BCAM-1839H | Recombinant Human BCAM protein, His & T7-tagged | +Inquiry |
BCAM-949R | Recombinant Rat BCAM Protein | +Inquiry |
BCAM-27252TH | Recombinant Human BCAM | +Inquiry |
BCAM-201H | Recombinant Human BCAM Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAM-1438RCL | Recombinant Rat BCAM cell lysate | +Inquiry |
BCAM-1708MCL | Recombinant Mouse BCAM cell lysate | +Inquiry |
BCAM-1649HCL | Recombinant Human BCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAM Products
Required fields are marked with *
My Review for All BCAM Products
Required fields are marked with *