Recombinant Human BCAN Protein, GST-tagged

Cat.No. : BCAN-115H
Product Overview : Human BCAN partial ORF ( NP_068767, 63 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : RPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYR
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCAN brevican [ Homo sapiens ]
Official Symbol BCAN
Synonyms BCAN; brevican; brevican core protein; BEHAB; brevican proteoglycan; chondroitin sulfate proteoglycan 7; CSPG7; MGC13038; chondroitin sulfate proteoglycan BEHAB; brain-enriched hyaluronan-binding protein;
Gene ID 63827
mRNA Refseq NM_021948
Protein Refseq NP_068767
UniProt ID Q96GW7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAN Products

Required fields are marked with *

My Review for All BCAN Products

Required fields are marked with *

0
cart-icon