Recombinant Human BCAN Protein, GST-tagged
| Cat.No. : | BCAN-115H |
| Product Overview : | Human BCAN partial ORF ( NP_068767, 63 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | RPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYR |
| Purity : | Glutathione Sepharose 4 Fast Flow |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCAN brevican [ Homo sapiens ] |
| Official Symbol | BCAN |
| Synonyms | BCAN; brevican; brevican core protein; BEHAB; brevican proteoglycan; chondroitin sulfate proteoglycan 7; CSPG7; MGC13038; chondroitin sulfate proteoglycan BEHAB; brain-enriched hyaluronan-binding protein; |
| Gene ID | 63827 |
| mRNA Refseq | NM_021948 |
| Protein Refseq | NP_068767 |
| UniProt ID | Q96GW7 |
| ◆ Recombinant Proteins | ||
| BCAN-114H | Recombinant Human BCAN Protein, GST-tagged | +Inquiry |
| BCAN-5437Z | Recombinant Zebrafish BCAN | +Inquiry |
| BCAN-300H | Active Recombinant Human BCAN, His-tagged | +Inquiry |
| BCAN-0075H | Recombinant Human BCAN Protein (Asp23-Pro911), C-His-tagged | +Inquiry |
| Bcan-373M | Recombinant Mouse Bcan Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCAN-160HCL | Recombinant Human BCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAN Products
Required fields are marked with *
My Review for All BCAN Products
Required fields are marked with *
