Recombinant Human BCAR3 Protein, GST-tagged

Cat.No. : BCAR3-122H
Product Overview : Human BCAR3 partial ORF ( AAH39895, 266 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.51 kDa
AA Sequence : YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCAR3 breast cancer anti-estrogen resistance 3 [ Homo sapiens ]
Official Symbol BCAR3
Synonyms BCAR3; breast cancer anti-estrogen resistance 3; breast cancer anti-estrogen resistance protein 3; NSP2; SH2D3B; novel SH2-containing protein 2; SH2 domain-containing protein 3B; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554;
Gene ID 8412
mRNA Refseq NM_003567
Protein Refseq NP_003558
MIM 604704
UniProt ID O75815

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAR3 Products

Required fields are marked with *

My Review for All BCAR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon