Recombinant Human BCAR3 Protein, GST-tagged

• Cat.No.: BCAR3-122H
• Product Overview: Human BCAR3 partial ORF ( AAH39895, 266 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.51 kDa
• AA Sequence: YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCAR3 breast cancer anti-estrogen resistance 3 [ Homo sapiens ]
• Official Symbol: BCAR3
• Synonyms: BCAR3; breast cancer anti-estrogen resistance 3; breast cancer anti-estrogen resistance protein 3; NSP2; SH2D3B; novel SH2-containing protein 2; SH2 domain-containing protein 3B; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554
• Gene ID: 8412
• mRNA Refseq: NM_003567
• Protein Refseq: NP_003558
• MIM: 604704
• UniProt ID: O75815