Recombinant Human BCAR3 protein, His-tagged
Cat.No. : | BCAR3-2594H |
Product Overview : | Recombinant Human BCAR3 protein(1-117 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-117 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BCAR3 breast cancer anti-estrogen resistance 3 [ Homo sapiens ] |
Official Symbol | BCAR3 |
Synonyms | BCAR3; breast cancer anti-estrogen resistance 3; breast cancer anti-estrogen resistance protein 3; NSP2; SH2D3B; novel SH2-containing protein 2; SH2 domain-containing protein 3B; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554; |
Gene ID | 8412 |
mRNA Refseq | NM_003567 |
Protein Refseq | NP_003558 |
MIM | 604704 |
UniProt ID | O75815 |
◆ Recombinant Proteins | ||
BCAR3-431H | Recombinant Human BCAR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCAR3-562H | Recombinant Human BCAR3 Protein, His/GST-tagged | +Inquiry |
BCAR3-337C | Recombinant Cynomolgus BCAR3 Protein, His-tagged | +Inquiry |
BCAR3-2594H | Recombinant Human BCAR3 protein, His-tagged | +Inquiry |
BCAR3-6347Z | Recombinant Zebrafish BCAR3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAR3-8497HCL | Recombinant Human BCAR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAR3 Products
Required fields are marked with *
My Review for All BCAR3 Products
Required fields are marked with *
0
Inquiry Basket