Recombinant Human BCAR3 protein, His-tagged
| Cat.No. : | BCAR3-2594H |
| Product Overview : | Recombinant Human BCAR3 protein(1-117 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-117 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BCAR3 breast cancer anti-estrogen resistance 3 [ Homo sapiens ] |
| Official Symbol | BCAR3 |
| Synonyms | BCAR3; breast cancer anti-estrogen resistance 3; breast cancer anti-estrogen resistance protein 3; NSP2; SH2D3B; novel SH2-containing protein 2; SH2 domain-containing protein 3B; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554; |
| Gene ID | 8412 |
| mRNA Refseq | NM_003567 |
| Protein Refseq | NP_003558 |
| MIM | 604704 |
| UniProt ID | O75815 |
| ◆ Recombinant Proteins | ||
| BCAR3-562H | Recombinant Human BCAR3 Protein, His/GST-tagged | +Inquiry |
| BCAR3-1759HFL | Recombinant Full Length Human BCAR3 Protein, C-Flag-tagged | +Inquiry |
| Bcar3-1841M | Recombinant Mouse Bcar3 Protein, Myc/DDK-tagged | +Inquiry |
| BCAR3-980M | Recombinant Mouse BCAR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCAR3-337C | Recombinant Cynomolgus BCAR3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCAR3-8497HCL | Recombinant Human BCAR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAR3 Products
Required fields are marked with *
My Review for All BCAR3 Products
Required fields are marked with *
