Recombinant Human BCAS2 Protein, GST-tagged
Cat.No. : | BCAS2-126H |
Product Overview : | Human BCAS2 partial ORF ( NP_005863, 116 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAS2 breast carcinoma amplified sequence 2 [ Homo sapiens ] |
Official Symbol | BCAS2 |
Synonyms | BCAS2; breast carcinoma amplified sequence 2; pre-mRNA-splicing factor SPF27; DAM1; Snt309; SPF27; breast carcinoma-amplified sequence 2; spliceosome-associated protein SPF 27; DNA amplified in mammary carcinoma 1 protein; spliceosome associated protein, amplified in breast cancer; |
Gene ID | 10286 |
mRNA Refseq | NM_005872 |
Protein Refseq | NP_005863 |
MIM | 605783 |
UniProt ID | O75934 |
◆ Recombinant Proteins | ||
BCAS2-125H | Recombinant Human BCAS2 Protein, GST-tagged | +Inquiry |
BCAS2-1603HF | Recombinant Full Length Human BCAS2 Protein, GST-tagged | +Inquiry |
BCAS2-301H | Recombinant Human BCAS2 Protein, His-tagged | +Inquiry |
BCAS2-4616C | Recombinant Chicken BCAS2 | +Inquiry |
BCAS2-27440TH | Recombinant Human BCAS2, T7 -tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAS2-8496HCL | Recombinant Human BCAS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCAS2 Products
Required fields are marked with *
My Review for All BCAS2 Products
Required fields are marked with *
0
Inquiry Basket