Recombinant Human BCHE Protein, GST-tagged

Cat.No. : BCHE-134H
Product Overview : Human BCHE partial ORF ( NP_000046, 493 a.a. - 602 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : RSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCHE butyrylcholinesterase [ Homo sapiens ]
Official Symbol BCHE
Synonyms BCHE; butyrylcholinesterase; CHE1, cholinesterase 1; cholinesterase; E1; cholinesterase 1; choline esterase II; pseudocholinesterase; butyrylcholine esterase; acylcholine acylhydrolase; CHE1;
Gene ID 590
mRNA Refseq NM_000055
Protein Refseq NP_000046
UniProt ID P06276

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCHE Products

Required fields are marked with *

My Review for All BCHE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon