Recombinant Human BCHE Protein, GST-tagged
| Cat.No. : | BCHE-134H |
| Product Overview : | Human BCHE partial ORF ( NP_000046, 493 a.a. - 602 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | RSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCHE butyrylcholinesterase [ Homo sapiens ] |
| Official Symbol | BCHE |
| Synonyms | BCHE; butyrylcholinesterase; CHE1, cholinesterase 1; cholinesterase; E1; cholinesterase 1; choline esterase II; pseudocholinesterase; butyrylcholine esterase; acylcholine acylhydrolase; CHE1; |
| Gene ID | 590 |
| mRNA Refseq | NM_000055 |
| Protein Refseq | NP_000046 |
| UniProt ID | P06276 |
| ◆ Recombinant Proteins | ||
| BCHE-2606H | Recombinant Human BCHE protein, His-tagged | +Inquiry |
| BCHE-303H | Recombinant Human BCHE Protein, His-tagged | +Inquiry |
| Bche-695M | Recombinant Mouse Bche Protein, MYC/DDK-tagged | +Inquiry |
| BCHE-6214C | Recombinant Chicken BCHE | +Inquiry |
| Bche-984M | Recombinant Mouse Bche Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
| BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
| BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
| BCHE-26067TH | Native Human BCHE | +Inquiry |
| BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCHE-2286MCL | Recombinant Mouse BCHE cell lysate | +Inquiry |
| BCHE-2196HCL | Recombinant Human BCHE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCHE Products
Required fields are marked with *
My Review for All BCHE Products
Required fields are marked with *
