Recombinant Human BCHE protein, His-tagged
| Cat.No. : | BCHE-2606H |
| Product Overview : | Recombinant Human BCHE protein(539-602 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 539-602 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BCHE butyrylcholinesterase [ Homo sapiens ] |
| Official Symbol | BCHE |
| Synonyms | BCHE; butyrylcholinesterase; CHE1, cholinesterase 1; cholinesterase; E1; cholinesterase 1; choline esterase II; pseudocholinesterase; butyrylcholine esterase; acylcholine acylhydrolase; CHE1; |
| Gene ID | 590 |
| mRNA Refseq | NM_000055 |
| Protein Refseq | NP_000046 |
| UniProt ID | P06276 |
| ◆ Recombinant Proteins | ||
| Bche-984M | Recombinant Mouse Bche Protein, His (Fc)-Avi-tagged | +Inquiry |
| Bche-695M | Recombinant Mouse Bche Protein, MYC/DDK-tagged | +Inquiry |
| BCHE-134H | Recombinant Human BCHE Protein, GST-tagged | +Inquiry |
| BCHE-10H | Recombinant Human BCHE, His-tagged | +Inquiry |
| BCHE-574H | Recombinant Human BCHE Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
| BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
| BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
| BCHE-26067TH | Native Human BCHE | +Inquiry |
| BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCHE-2286MCL | Recombinant Mouse BCHE cell lysate | +Inquiry |
| BCHE-2196HCL | Recombinant Human BCHE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCHE Products
Required fields are marked with *
My Review for All BCHE Products
Required fields are marked with *
