Recombinant Human BCHE protein, His-tagged
Cat.No. : | BCHE-2606H |
Product Overview : | Recombinant Human BCHE protein(539-602 aa), fused to His tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 539-602 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BCHE butyrylcholinesterase [ Homo sapiens ] |
Official Symbol | BCHE |
Synonyms | BCHE; butyrylcholinesterase; CHE1, cholinesterase 1; cholinesterase; E1; cholinesterase 1; choline esterase II; pseudocholinesterase; butyrylcholine esterase; acylcholine acylhydrolase; CHE1; |
Gene ID | 590 |
mRNA Refseq | NM_000055 |
Protein Refseq | NP_000046 |
UniProt ID | P06276 |
◆ Recombinant Proteins | ||
BCHE-2077HFL | Recombinant Full Length Human BCHE Protein, C-Flag-tagged | +Inquiry |
BCHE-5350D | Recombinant Dog BCHE protein, His-tagged | +Inquiry |
BCHE-10H | Recombinant Human BCHE, His-tagged | +Inquiry |
Bche-575R | Recombinant Rat Bche Protein, His-tagged | +Inquiry |
BCHE-901H | Active Recombinant Human BCHE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
BCHE-26067TH | Native Human BCHE | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCHE-2196HCL | Recombinant Human BCHE cell lysate | +Inquiry |
BCHE-2286MCL | Recombinant Mouse BCHE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCHE Products
Required fields are marked with *
My Review for All BCHE Products
Required fields are marked with *
0
Inquiry Basket