Recombinant Human BCL2A1 Protein, GST-tagged

Cat.No. : BCL2A1-145H
Product Overview : Human BCL2A1 full-length ORF ( NP_004040.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 46.5 kDa
AA Sequence : MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCL2A1 BCL2-related protein A1 [ Homo sapiens ]
Official Symbol BCL2A1
Synonyms BCL2A1; BCL2-related protein A1; HBPA1; bcl-2-related protein A1; ACC 1; ACC 2; BCL2L5; BFL1; GRS; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein; ACC-1; ACC-2;
Gene ID 597
mRNA Refseq NM_001114735
Protein Refseq NP_001108207
MIM 601056
UniProt ID Q16548

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL2A1 Products

Required fields are marked with *

My Review for All BCL2A1 Products

Required fields are marked with *

0
cart-icon