Recombinant Human BCL2A1 Protein, GST-tagged
Cat.No. : | BCL2A1-144H |
Product Overview : | Human BCL2A1 full-length ORF ( AAH16281, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.99 kDa |
AA Sequence : | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL2A1 BCL2-related protein A1 [ Homo sapiens ] |
Official Symbol | BCL2A1 |
Synonyms | BCL2A1; BCL2-related protein A1; HBPA1; bcl-2-related protein A1; ACC 1; ACC 2; BCL2L5; BFL1; GRS; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein; ACC-1; ACC-2; |
Gene ID | 597 |
mRNA Refseq | NM_001114735 |
Protein Refseq | NP_001108207 |
MIM | 601056 |
UniProt ID | Q16548 |
◆ Recombinant Proteins | ||
BCL2A1-1590HF | Recombinant Full Length Human BCL2A1 Protein, GST-tagged | +Inquiry |
BCL2A1-10178H | Recombinant Human BCL2A1, GST-tagged | +Inquiry |
BCL2A1-1046H | Recombinant Human BCL2A1 Protein (M1-E149), Tag Free | +Inquiry |
BCL2A1-862H | Recombinant Human BCL2A1 Protein | +Inquiry |
BCL2A1-1624HF | Recombinant Full Length Human BCL2A1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2A1-59HCL | Recombinant Human BCL2A1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2A1 Products
Required fields are marked with *
My Review for All BCL2A1 Products
Required fields are marked with *
0
Inquiry Basket