Recombinant Human BCL2L10 Protein, GST-tagged

• Cat.No.: BCL2L10-149H
• Product Overview: Human BCL2L10 partial ORF ( NP_065129, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq]
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.86 kDa
• AA Sequence: MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL2L10 BCL2-like 10 (apoptosis facilitator) [ Homo sapiens ]
• Official Symbol: BCL2L10
• Synonyms: BCL2L10; BCL2-like 10 (apoptosis facilitator); bcl-2-like protein 10; BCL B; Boo; Diva; bcl2-L-10; apoptosis regulator Bcl-B; anti-apoptotic protein NrH; BCL-B; MGC129810; MGC129811
• Gene ID: 10017
• mRNA Refseq: NM_020396
• Protein Refseq: NP_065129
• MIM: 606910
• UniProt ID: Q9HD36