Recombinant Human BCL2L2 protein

Cat.No. : BCL2L2-1588H
Product Overview : Recombinant Human BCL2L2 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 171
Description : This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene.
Form : 0.2μm Filtered concentrated solution in 25 mM Hepes, pH 7.4, 100 mM KCl, 10 % Glycerol, 5 % Trehalose, 0.02 % Tween-80.
Molecular Mass : Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 171 amino acids.
AA Sequence : ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT
Endotoxin : Less than 1 EU/µg of rHuBcl-w as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Gene Name BCL2L2
Official Symbol BCL2L2
Synonyms BCL2L2; BCL2-like 2; bcl-2-like protein 2; BCL W; KIAA0271; PPP1R51; protein phosphatase 1; regulatory subunit 51; apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51; BCLW; BCL-W; BCL2-L-2;
Gene ID 599
mRNA Refseq NM_001199839
Protein Refseq NP_001186768
MIM 601931
UniProt ID Q92843

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL2L2 Products

Required fields are marked with *

My Review for All BCL2L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon