| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
171 |
| Description : |
This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. |
| Form : |
0.2μm Filtered concentrated solution in 25 mM Hepes, pH 7.4, 100 mM KCl, 10 % Glycerol, 5 % Trehalose, 0.02 % Tween-80. |
| Molecular Mass : |
Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 171 amino acids. |
| AA Sequence : |
ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT |
| Endotoxin : |
Less than 1 EU/µg of rHuBcl-w as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
