Recombinant Human BCL7A protein, GST-tagged
Cat.No. : | BCL7A-7854H |
Product Overview : | Recombinant Human BCL7A protein(50-210 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 50-210 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | PVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | BCL7A B-cell CLL/lymphoma 7A [ Homo sapiens ] |
Official Symbol | BCL7A |
Synonyms | BCL7A; B-cell CLL/lymphoma 7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma-7; |
mRNA Refseq | NM_001024808 |
Protein Refseq | NP_001019979 |
MIM | 601406 |
UniProt ID | Q4VC05 |
Gene ID | 605 |
◆ Recombinant Proteins | ||
BCL7A-2465H | Recombinant Human BCL7A Protein, MYC/DDK-tagged | +Inquiry |
BCL7A-051H | Recombinant Human BCL7A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCL7A-162H | Recombinant Human BCL7A Protein, GST-tagged | +Inquiry |
BCL7A-7854H | Recombinant Human BCL7A protein, GST-tagged | +Inquiry |
BCL7A-5634H | Recombinant Human BCL7A protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL7A Products
Required fields are marked with *
My Review for All BCL7A Products
Required fields are marked with *
0
Inquiry Basket