Recombinant Human BCL7A Protein, GST-tagged
| Cat.No. : | BCL7A-163H |
| Product Overview : | Human BCL7A partial ORF ( NP_066273.1, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 31.68 kDa |
| AA Sequence : | MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCL7A B-cell CLL/lymphoma 7A [ Homo sapiens ] |
| Official Symbol | BCL7A |
| Synonyms | BCL7A; B-cell CLL/lymphoma 7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma-7; |
| Gene ID | 605 |
| mRNA Refseq | NM_001024808 |
| Protein Refseq | NP_001019979 |
| MIM | 601406 |
| UniProt ID | Q4VC05 |
| ◆ Recombinant Proteins | ||
| BCL7A-1550HF | Recombinant Full Length Human BCL7A Protein, GST-tagged | +Inquiry |
| BCL7A-308H | Recombinant Human BCL7A Protein, His-tagged | +Inquiry |
| BCL7A-11840Z | Recombinant Zebrafish BCL7A | +Inquiry |
| BCL7A-7072H | Recombinant Human BCL7A, His-tagged | +Inquiry |
| BCL7A-768H | Recombinant Human BCL7A Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL7A Products
Required fields are marked with *
My Review for All BCL7A Products
Required fields are marked with *
