Recombinant Human BCL7B Protein, GST-tagged
Cat.No. : | BCL7B-164H |
Product Overview : | Human BCL7B full-length ORF ( NP_001698.2, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL7B B-cell CLL/lymphoma 7B [ Homo sapiens ] |
Official Symbol | BCL7B |
Synonyms | BCL7B; B-cell CLL/lymphoma 7B; B-cell CLL/lymphoma 7 protein family member B; |
Gene ID | 9275 |
mRNA Refseq | NM_001197244 |
Protein Refseq | NP_001184173 |
MIM | 605846 |
UniProt ID | Q9BQE9 |
◆ Recombinant Proteins | ||
BCL7B-164H | Recombinant Human BCL7B Protein, GST-tagged | +Inquiry |
BCL7B-165H | Recombinant Human BCL7B Protein, GST-tagged | +Inquiry |
BCL7B-525R | Recombinant Rhesus monkey BCL7B Protein, His-tagged | +Inquiry |
BCL7B-2354M | Recombinant Mouse BCL7B Protein | +Inquiry |
Bcl7b-702M | Recombinant Mouse Bcl7b Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL7B-8477HCL | Recombinant Human BCL7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL7B Products
Required fields are marked with *
My Review for All BCL7B Products
Required fields are marked with *