Recombinant Human BCL7B Protein, GST-tagged

• Cat.No.: BCL7B-164H
• Product Overview: Human BCL7B full-length ORF ( NP_001698.2, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined. [provided by RefSeq
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 48.6 kDa
• AA Sequence: MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL7B B-cell CLL/lymphoma 7B [ Homo sapiens ]
• Official Symbol: BCL7B
• Synonyms: BCL7B; B-cell CLL/lymphoma 7B; B-cell CLL/lymphoma 7 protein family member B
• Gene ID: 9275
• mRNA Refseq: NM_001197244
• Protein Refseq: NP_001184173
• MIM: 605846
• UniProt ID: Q9BQE9