Recombinant Human BCOR Protein, GST-tagged

Cat.No. : BCOR-175H
Product Overview : Human BCOR partial ORF ( NP_060215, 1361 a.a. - 1460 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene was identified as an interacting corepressor of BCL6, a POZ/zinc finger transcription repressor that is required for germinal center formation and may influence apoptosis. This protein selectively interacts with the POZ domain of BCL6, but not with eight other POZ proteins. Specific class I and II histone deacetylases (HDACs) have been shown to interact with this protein, which suggests a possible link between the two classes of HDACs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCOR BCL6 corepressor [ Homo sapiens ]
Official Symbol BCOR
Synonyms BCOR; BCL6 corepressor; BCL6 co repressor; BCL-6 corepressor; FLJ20285; KIAA1575; BCL6 co-repressor; BCL-6 interacting corepressor; MAA2; ANOP2; MCOPS2; FLJ38041; MGC71031; MGC131961;
Gene ID 54880
mRNA Refseq NM_001123383
Protein Refseq NP_001116855
MIM 300485
UniProt ID Q6W2J9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCOR Products

Required fields are marked with *

My Review for All BCOR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon