Recombinant Human BCR protein(161-260 aa), C-His-tagged
| Cat.No. : | BCR-2637H |
| Product Overview : | Recombinant Human BCR protein(P11274)(161-260 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 161-260 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | IRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNL |
| Gene Name | BCR breakpoint cluster region [ Homo sapiens ] |
| Official Symbol | BCR |
| Synonyms | BCR; breakpoint cluster region; BCR1, D22S11; breakpoint cluster region protein; ALL; CML; D22S662; PHL; renal carcinoma antigen NY-REN-26; BCR1; D22S11; FLJ16453; |
| Gene ID | 613 |
| mRNA Refseq | NM_004327 |
| Protein Refseq | NP_004318 |
| MIM | 151410 |
| UniProt ID | P11274 |
| ◆ Recombinant Proteins | ||
| BCR-10196H | Recombinant Human BCR, His-tagged | +Inquiry |
| BCR-0218H | Recombinant Human BCR Protein (174-331), His-tagged | +Inquiry |
| BCR-558H | Recombinant Human BCR Protein, His-tagged | +Inquiry |
| BCR-177H | Recombinant Human BCR Protein, GST-tagged | +Inquiry |
| Bcr-463M | Recombinant Mouse Bcr Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCR-166HCL | Recombinant Human BCR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCR Products
Required fields are marked with *
My Review for All BCR Products
Required fields are marked with *
