Recombinant Human BEND7 Protein, GST-tagged
Cat.No. : | BEND7-194H |
Product Overview : | Human BEND7 full-length ORF ( AAH31618.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 66.7 kDa |
AA Sequence : | MRRLLNDSTGRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPSSRGVWNELPPQSGQFSGQYGTRSRTFQSQPHPTTSSNGMVVNKHSEGSHGGELPVVNSSAGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTAVSRKRNKKKKVPPKTVEPLTVKQKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSEIADSDERLDGIALPPTVV |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BEND7 BEN domain containing 7 [ Homo sapiens ] |
Official Symbol | BEND7 |
Synonyms | BEND7; BEN domain containing 7; C10orf30, chromosome 10 open reading frame 30; BEN domain-containing protein 7; FLJ40283; C10orf30; MGC35247; |
Gene ID | 222389 |
mRNA Refseq | NM_001100912 |
Protein Refseq | NP_001094382 |
UniProt ID | Q8N7W2 |
◆ Recombinant Proteins | ||
BEND7-194H | Recombinant Human BEND7 Protein, GST-tagged | +Inquiry |
BEND7-2375M | Recombinant Mouse BEND7 Protein | +Inquiry |
BEND7-5443C | Recombinant Chicken BEND7 | +Inquiry |
BEND7-2598H | Recombinant Human BEND7 Protein, His-tagged | +Inquiry |
BEND7-1011M | Recombinant Mouse BEND7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEND7-63HCL | Recombinant Human BEND7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEND7 Products
Required fields are marked with *
My Review for All BEND7 Products
Required fields are marked with *