Recombinant Human BEND7 Protein, GST-tagged

Cat.No. : BEND7-194H
Product Overview : Human BEND7 full-length ORF ( AAH31618.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 66.7 kDa
AA Sequence : MRRLLNDSTGRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPSSRGVWNELPPQSGQFSGQYGTRSRTFQSQPHPTTSSNGMVVNKHSEGSHGGELPVVNSSAGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTAVSRKRNKKKKVPPKTVEPLTVKQKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSEIADSDERLDGIALPPTVV
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BEND7 BEN domain containing 7 [ Homo sapiens ]
Official Symbol BEND7
Synonyms BEND7; BEN domain containing 7; C10orf30, chromosome 10 open reading frame 30; BEN domain-containing protein 7; FLJ40283; C10orf30; MGC35247;
Gene ID 222389
mRNA Refseq NM_001100912
Protein Refseq NP_001094382
UniProt ID Q8N7W2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BEND7 Products

Required fields are marked with *

My Review for All BEND7 Products

Required fields are marked with *

0
cart-icon
0
compare icon