Recombinant Human BEND7 Protein, GST-tagged
| Cat.No. : | BEND7-194H |
| Product Overview : | Human BEND7 full-length ORF ( AAH31618.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 66.7 kDa |
| AA Sequence : | MRRLLNDSTGRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPSSRGVWNELPPQSGQFSGQYGTRSRTFQSQPHPTTSSNGMVVNKHSEGSHGGELPVVNSSAGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTAVSRKRNKKKKVPPKTVEPLTVKQKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSEIADSDERLDGIALPPTVV |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BEND7 BEN domain containing 7 [ Homo sapiens ] |
| Official Symbol | BEND7 |
| Synonyms | BEND7; BEN domain containing 7; C10orf30, chromosome 10 open reading frame 30; BEN domain-containing protein 7; FLJ40283; C10orf30; MGC35247; |
| Gene ID | 222389 |
| mRNA Refseq | NM_001100912 |
| Protein Refseq | NP_001094382 |
| UniProt ID | Q8N7W2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEND7 Products
Required fields are marked with *
My Review for All BEND7 Products
Required fields are marked with *
