Recombinant Human BET1 Protein, GST-tagged
| Cat.No. : | BET1-197H |
| Product Overview : | Human BET1 full-length ORF ( AAH00899, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has not been determined. [provided by RefSeq |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 38.72 kDa |
| AA Sequence : | MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BET1 Bet1 golgi vesicular membrane trafficking protein [ Homo sapiens (human) ] |
| Official Symbol | BET1 |
| Synonyms | HBET1;BET1 |
| Gene ID | 10282 |
| mRNA Refseq | NM_005868 |
| Protein Refseq | NP_005859 |
| MIM | 605456 |
| UniProt ID | O15155.1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BET1 Products
Required fields are marked with *
My Review for All BET1 Products
Required fields are marked with *



