Recombinant Human BET1 Protein, GST-tagged

Cat.No. : BET1-198H
Product Overview : Human BET1 partial ORF ( NP_005859, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has not been determined. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.19 kDa
AA Sequence : MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BET1 Bet1 golgi vesicular membrane trafficking protein [ Homo sapiens (human) ]
Official Symbol BET1
Synonyms HBET1;BET1
Gene ID 10282
mRNA Refseq NM_005868
Protein Refseq NP_005859
MIM 605456
UniProt ID O15155.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BET1 Products

Required fields are marked with *

My Review for All BET1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon