Recombinant Human BET1 Protein, GST-tagged
Cat.No. : | BET1-198H |
Product Overview : | Human BET1 partial ORF ( NP_005859, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has not been determined. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.19 kDa |
AA Sequence : | MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BET1 Bet1 golgi vesicular membrane trafficking protein [ Homo sapiens (human) ] |
Official Symbol | BET1 |
Synonyms | HBET1;BET1 |
Gene ID | 10282 |
mRNA Refseq | NM_005868 |
Protein Refseq | NP_005859 |
MIM | 605456 |
UniProt ID | O15155.1 |
◆ Recombinant Proteins | ||
BET1-1575HF | Recombinant Full Length Human BET1 Protein, GST-tagged | +Inquiry |
BET1-360R | Recombinant Rhesus Macaque BET1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BET1-532R | Recombinant Rhesus monkey BET1 Protein, His-tagged | +Inquiry |
RFL35113HF | Recombinant Full Length Human Bet1 Homolog(Bet1) Protein, His-Tagged | +Inquiry |
BET1-969R | Recombinant Rat BET1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BET1-8465HCL | Recombinant Human BET1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BET1 Products
Required fields are marked with *
My Review for All BET1 Products
Required fields are marked with *