Recombinant Human BEX1 Protein, GST-tagged
| Cat.No. : | BEX1-199H |
| Product Overview : | Human BEX1 full-length ORF ( NP_060946.3, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 41.3 kDa |
| AA Sequence : | MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BEX1 brain expressed, X-linked 1 [ Homo sapiens ] |
| Official Symbol | BEX1 |
| Synonyms | BEX1; brain expressed, X-linked 1; protein BEX1; brain-expressed X-linked protein 1; ovarian granulosa cell 13.0 kDa protein hGR74; BEX2; HBEX2; HGR74-h; |
| Gene ID | 55859 |
| mRNA Refseq | NM_018476 |
| Protein Refseq | NP_060946 |
| MIM | 300690 |
| UniProt ID | Q9HBH7 |
| ◆ Recombinant Proteins | ||
| BEX1-91C | Recombinant Cynomolgus Monkey BEX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BEX1-629R | Recombinant Rat BEX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BEX1-2383M | Recombinant Mouse BEX1 Protein | +Inquiry |
| BEX1-971R | Recombinant Rat BEX1 Protein | +Inquiry |
| BEX1-1615HF | Recombinant Full Length Human BEX1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BEX1-8464HCL | Recombinant Human BEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEX1 Products
Required fields are marked with *
My Review for All BEX1 Products
Required fields are marked with *



