Recombinant Human BEX1 Protein, GST-tagged

Cat.No. : BEX1-199H
Product Overview : Human BEX1 full-length ORF ( NP_060946.3, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 41.3 kDa
AA Sequence : MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BEX1 brain expressed, X-linked 1 [ Homo sapiens ]
Official Symbol BEX1
Synonyms BEX1; brain expressed, X-linked 1; protein BEX1; brain-expressed X-linked protein 1; ovarian granulosa cell 13.0 kDa protein hGR74; BEX2; HBEX2; HGR74-h;
Gene ID 55859
mRNA Refseq NM_018476
Protein Refseq NP_060946
MIM 300690
UniProt ID Q9HBH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BEX1 Products

Required fields are marked with *

My Review for All BEX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon