Recombinant Human BEX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BEX1-4832H
Product Overview : BEX1 MS Standard C13 and N15-labeled recombinant protein (NP_060946) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : BEX1 (Brain Expressed X-Linked 1) is a Protein Coding gene. Among its related pathways are p75(NTR)-mediated signaling. Gene Ontology (GO) annotations related to this gene include RNA polymerase II activating transcription factor binding. An important paralog of this gene is BEX2.
Molecular Mass : 14.9 kDa
AA Sequence : MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BEX1 brain expressed X-linked 1 [ Homo sapiens (human) ]
Official Symbol BEX1
Synonyms BEX1; brain expressed, X-linked 1; protein BEX1; brain-expressed X-linked protein 1; ovarian granulosa cell 13.0 kDa protein hGR74; BEX2; HBEX2; HGR74-h;
Gene ID 55859
mRNA Refseq NM_018476
Protein Refseq NP_060946
MIM 300690
UniProt ID Q9HBH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BEX1 Products

Required fields are marked with *

My Review for All BEX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon