Recombinant Human BEX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BEX1-4832H
• Product Overview: BEX1 MS Standard C13 and N15-labeled recombinant protein (NP_060946) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: BEX1 (Brain Expressed X-Linked 1) is a Protein Coding gene. Among its related pathways are p75(NTR)-mediated signaling. Gene Ontology (GO) annotations related to this gene include RNA polymerase II activating transcription factor binding. An important paralog of this gene is BEX2.
• Molecular Mass: 14.9 kDa
• AA Sequence: MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BEX1 brain expressed X-linked 1 [ Homo sapiens (human) ]
• Official Symbol: BEX1
• Synonyms: BEX1; brain expressed, X-linked 1; protein BEX1; brain-expressed X-linked protein 1; ovarian granulosa cell 13.0 kDa protein hGR74; BEX2; HBEX2; HGR74-h
• Gene ID: 55859
• mRNA Refseq: NM_018476
• Protein Refseq: NP_060946
• MIM: 300690
• UniProt ID: Q9HBH7