Recombinant Human BEX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BEX1-4832H |
Product Overview : | BEX1 MS Standard C13 and N15-labeled recombinant protein (NP_060946) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | BEX1 (Brain Expressed X-Linked 1) is a Protein Coding gene. Among its related pathways are p75(NTR)-mediated signaling. Gene Ontology (GO) annotations related to this gene include RNA polymerase II activating transcription factor binding. An important paralog of this gene is BEX2. |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BEX1 brain expressed X-linked 1 [ Homo sapiens (human) ] |
Official Symbol | BEX1 |
Synonyms | BEX1; brain expressed, X-linked 1; protein BEX1; brain-expressed X-linked protein 1; ovarian granulosa cell 13.0 kDa protein hGR74; BEX2; HBEX2; HGR74-h; |
Gene ID | 55859 |
mRNA Refseq | NM_018476 |
Protein Refseq | NP_060946 |
MIM | 300690 |
UniProt ID | Q9HBH7 |
◆ Recombinant Proteins | ||
BEX1-199H | Recombinant Human BEX1 Protein, GST-tagged | +Inquiry |
BEX1-1615HF | Recombinant Full Length Human BEX1 Protein, GST-tagged | +Inquiry |
BEX1-2383M | Recombinant Mouse BEX1 Protein | +Inquiry |
BEX1-629R | Recombinant Rat BEX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BEX1-971R | Recombinant Rat BEX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEX1-8464HCL | Recombinant Human BEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEX1 Products
Required fields are marked with *
My Review for All BEX1 Products
Required fields are marked with *