Recombinant Human BGN protein, His-SUMO & Myc-tagged
| Cat.No. : | BGN-2590H |
| Product Overview : | Recombinant Human BGN protein(P21810)(38-368aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 38-368aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 57.2 kDa |
| AA Sequence : | DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BGN biglycan [ Homo sapiens ] |
| Official Symbol | BGN |
| Synonyms | BGN; biglycan; biglycan proteoglycan; DSPG1; SLRR1A; bone/cartilage proteoglycan I; bone/cartilage proteoglycan-I; small leucine-rich protein 1A; dermatan sulphate proteoglycan I; PGI; PG-S1; |
| Gene ID | 633 |
| mRNA Refseq | NM_001711 |
| Protein Refseq | NP_001702 |
| MIM | 301870 |
| UniProt ID | P21810 |
| ◆ Recombinant Proteins | ||
| BGN-1427H | Recombinant Human BGN Protein (Glu20-Lys368), C-His tagged | +Inquiry |
| BGN-3401H | Recombinant Human BGN protein, His-tagged | +Inquiry |
| BGN-2590H | Recombinant Human BGN protein, His-SUMO & Myc-tagged | +Inquiry |
| BGN-44H | Recombinant Human BGN protein (Asp38-Lys368), His-tagged | +Inquiry |
| BGN-206H | Recombinant Human BGN Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BGN Products
Required fields are marked with *
My Review for All BGN Products
Required fields are marked with *
