Recombinant Human BGN protein, His-SUMO & Myc-tagged
Cat.No. : | BGN-2590H |
Product Overview : | Recombinant Human BGN protein(P21810)(38-368aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 38-368aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.2 kDa |
AA Sequence : | DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BGN biglycan [ Homo sapiens ] |
Official Symbol | BGN |
Synonyms | BGN; biglycan; biglycan proteoglycan; DSPG1; SLRR1A; bone/cartilage proteoglycan I; bone/cartilage proteoglycan-I; small leucine-rich protein 1A; dermatan sulphate proteoglycan I; PGI; PG-S1; |
Gene ID | 633 |
mRNA Refseq | NM_001711 |
Protein Refseq | NP_001702 |
MIM | 301870 |
UniProt ID | P21810 |
◆ Recombinant Proteins | ||
BGN-44H | Recombinant Human BGN protein (Asp38-Lys368), His-tagged | +Inquiry |
BGN-1427H | Recombinant Human BGN Protein (Glu20-Lys368), C-His tagged | +Inquiry |
BGN-2339M | Recombinant Mouse BGN protein(Met1-Lys369), hFc-tagged | +Inquiry |
BGN-1428H | Recombinant Human BGN Protein (Val49-Leu182), N-His tagged | +Inquiry |
BGN-2590H | Recombinant Human BGN protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Native Proteins | ||
BGN-13HFL | Active Recombinant Full Length Human BGN Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BGN Products
Required fields are marked with *
My Review for All BGN Products
Required fields are marked with *