Recombinant Human BHLHE40 Protein, GST-tagged

Cat.No. : BHLHE40-207H
Product Overview : Human BHLHB2 partial ORF ( NP_003661, 130 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. The encoded protein is believed to be involved in the control of cell differentiation.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BHLHE40 basic helix-loop-helix family, member e40 [ Homo sapiens ]
Official Symbol BHLHE40
Synonyms BHLHE40; basic helix-loop-helix family, member e40; basic helix loop helix domain containing, class B, 2 , BHLHB2, STRA13; class E basic helix-loop-helix protein 40; differentiated embryo chondrocyte expressed gene 1; bHLHe40; DEC1; differentially expressed in chondrocytes 1; class B basic helix-loop-helix protein 2; stimulated by retinoic acid gene 13 protein; enhancer-of-split and hairy-related protein 2; differentially expressed in chondrocytes protein 1; basic helix-loop-helix domain containing, class B, 2; HLHB2; BHLHB2; STRA13; Stra14; SHARP-2; FLJ99214;
Gene ID 8553
mRNA Refseq NM_003670
Protein Refseq NP_003661
MIM 604256
UniProt ID O14503

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BHLHE40 Products

Required fields are marked with *

My Review for All BHLHE40 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon