Recombinant Human BHMT Protein, GST-tagged
| Cat.No. : | BHMT-213H |
| Product Overview : | Human BHMT full-length ORF ( AAH12616, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 70.40 kDa |
| AA Sequence : | MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BHMT betaine--homocysteine S-methyltransferase [ Homo sapiens ] |
| Official Symbol | BHMT |
| Synonyms | BHMT; betaine--homocysteine S-methyltransferase; betaine--homocysteine S-methyltransferase 1; betaine homocysteine methyltransferase; BHMT1; |
| Gene ID | 635 |
| mRNA Refseq | NM_001713 |
| Protein Refseq | NP_001704 |
| MIM | 602888 |
| UniProt ID | Q93088 |
| ◆ Recombinant Proteins | ||
| BHMT-488H | Recombinant Human BHMT Protein, His-tagged | +Inquiry |
| BHMT-213H | Recombinant Human BHMT Protein, GST-tagged | +Inquiry |
| BHMT-1621HF | Recombinant Full Length Human BHMT Protein, GST-tagged | +Inquiry |
| BHMT-10223H | Recombinant Human BHMT, GST-tagged | +Inquiry |
| BHMT-214H | Recombinant Human BHMT Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BHMT-8458HCL | Recombinant Human BHMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BHMT Products
Required fields are marked with *
My Review for All BHMT Products
Required fields are marked with *
