Recombinant Human BHMT Protein, GST-tagged

• Cat.No.: BHMT-214H
• Product Overview: Human BHMT partial ORF ( NP_001704.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVN
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BHMT betaine--homocysteine S-methyltransferase [ Homo sapiens ]
• Official Symbol: BHMT
• Synonyms: BHMT; betaine--homocysteine S-methyltransferase; betaine--homocysteine S-methyltransferase 1; betaine homocysteine methyltransferase; BHMT1
• Gene ID: 635
• mRNA Refseq: NM_001713
• Protein Refseq: NP_001704
• MIM: 602888
• UniProt ID: Q93088