Recombinant Human BHMT Protein, GST-tagged
Cat.No. : | BHMT-214H |
Product Overview : | Human BHMT partial ORF ( NP_001704.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVN |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BHMT betaine--homocysteine S-methyltransferase [ Homo sapiens ] |
Official Symbol | BHMT |
Synonyms | BHMT; betaine--homocysteine S-methyltransferase; betaine--homocysteine S-methyltransferase 1; betaine homocysteine methyltransferase; BHMT1; |
Gene ID | 635 |
mRNA Refseq | NM_001713 |
Protein Refseq | NP_001704 |
MIM | 602888 |
UniProt ID | Q93088 |
◆ Recombinant Proteins | ||
BHMT-1621HF | Recombinant Full Length Human BHMT Protein, GST-tagged | +Inquiry |
Bhmt-709M | Recombinant Mouse Bhmt Protein, MYC/DDK-tagged | +Inquiry |
BHMT-10223H | Recombinant Human BHMT, GST-tagged | +Inquiry |
BHMT-981R | Recombinant Rat BHMT Protein | +Inquiry |
BHMT-213H | Recombinant Human BHMT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BHMT-8458HCL | Recombinant Human BHMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BHMT Products
Required fields are marked with *
My Review for All BHMT Products
Required fields are marked with *