Recombinant Human BLCAP Protein

Cat.No. : BLCAP-236H
Product Overview : Human BLCAP full-length ORF (ADR82653.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene was identified using a differential display procedure with tumor biopsies obtained from a noninvasive and an invasive bladder transitional cell carcinoma. Although database searches revealed no homology to any human gene at the time of identification, mouse, rat and zebrafish orthologs have since been identified. The function of this differentially expressed protein is not yet known but it appears to be down-regulated during bladder cancer progression.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 9.6 kDa
AA Sequence : MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name BLCAP bladder cancer associated protein [ Homo sapiens ]
Official Symbol BLCAP
Synonyms Bc10; Bladder cancer 10 kDa protein; Bladder cancer related protein (10kD); Bladder cancer-associated protein; BLCAP; BLCAP_HUMAN; bladder cancer associated protein
Gene ID 10904
mRNA Refseq NM_006698.3
Protein Refseq NP_006689.1
MIM 613110
UniProt ID P62952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLCAP Products

Required fields are marked with *

My Review for All BLCAP Products

Required fields are marked with *

0
cart-icon
0
compare icon