Recombinant Human BLCAP Protein
Cat.No. : | BLCAP-236H |
Product Overview : | Human BLCAP full-length ORF (ADR82653.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene was identified using a differential display procedure with tumor biopsies obtained from a noninvasive and an invasive bladder transitional cell carcinoma. Although database searches revealed no homology to any human gene at the time of identification, mouse, rat and zebrafish orthologs have since been identified. The function of this differentially expressed protein is not yet known but it appears to be down-regulated during bladder cancer progression. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 9.6 kDa |
AA Sequence : | MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | BLCAP bladder cancer associated protein [ Homo sapiens ] |
Official Symbol | BLCAP |
Synonyms | Bc10; Bladder cancer 10 kDa protein; Bladder cancer related protein (10kD); Bladder cancer-associated protein; BLCAP; BLCAP_HUMAN; bladder cancer associated protein |
Gene ID | 10904 |
mRNA Refseq | NM_006698.3 |
Protein Refseq | NP_006689.1 |
MIM | 613110 |
UniProt ID | P62952 |
◆ Recombinant Proteins | ||
BLCAP-9045Z | Recombinant Zebrafish BLCAP | +Inquiry |
BLCAP-2413M | Recombinant Mouse BLCAP Protein | +Inquiry |
RFL18422DF | Recombinant Full Length Danio Rerio Bladder Cancer-Associated Protein(Blcap) Protein, His-Tagged | +Inquiry |
BLCAP-370R | Recombinant Rhesus Macaque BLCAP Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30637HF | Recombinant Full Length Human Bladder Cancer-Associated Protein(Blcap) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLCAP Products
Required fields are marked with *
My Review for All BLCAP Products
Required fields are marked with *