Recombinant Human BLCAP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BLCAP-6097H |
Product Overview : | BLCAP MS Standard C13 and N15-labeled recombinant protein (NP_006689) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that reduces cell growth by stimulating apoptosis. Alternative splicing and the use of alternative promoters result in multiple transcript variants encoding the same protein. This gene is imprinted in brain where different transcript variants are expressed from each parental allele. Transcript variants initiating from the upstream promoter are expressed preferentially from the maternal allele, while transcript variants initiating downstream of the interspersed NNAT gene (GeneID:4826) are expressed from the paternal allele. Transcripts at this locus may also undergo A to I editing, resulting in amino acid changes at three positions in the N-terminus of the protein. |
Molecular Mass : | 9.7 kDa |
AA Sequence : | MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BLCAP bladder cancer associated protein [ Homo sapiens (human) ] |
Official Symbol | BLCAP |
Synonyms | Bc10; Bladder cancer 10 kDa protein; Bladder cancer related protein (10kD); Bladder cancer-associated protein; BLCAP; BLCAP_HUMAN; bladder cancer associated protein |
Gene ID | 10904 |
mRNA Refseq | NM_006698 |
Protein Refseq | NP_006689 |
MIM | 613110 |
UniProt ID | P62952 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLCAP Products
Required fields are marked with *
My Review for All BLCAP Products
Required fields are marked with *