Recombinant Human BLMH, His-tagged

Cat.No. : BLMH-26116TH
Product Overview : Recombinant fragment, corresponding to amino acids 309-455 of Human BLMH with N terminal His tag; 147 amino acids, 20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 309-455 a.a.
Description : Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 98 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHEL VFGVSLKNMNKAERLTFGESLMTHAMTFTAVSEKDDQD GAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVV DRKHVPEEVLAVLEQEPIILPAWDPMGALAE
Gene Name BLMH bleomycin hydrolase [ Homo sapiens ]
Official Symbol BLMH
Synonyms BLMH; bleomycin hydrolase; BH;
Gene ID 642
mRNA Refseq NM_000386
Protein Refseq NP_000377
MIM 602403
Uniprot ID Q13867
Chromosome Location 17q11.2
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function aminopeptidase activity; carboxypeptidase activity; cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLMH Products

Required fields are marked with *

My Review for All BLMH Products

Required fields are marked with *

0
cart-icon