Recombinant Human BLOC1S1 Protein, GST-tagged
Cat.No. : | BLOC1S1-247H |
Product Overview : | Human BLOC1S1 partial ORF ( NP_001478, 31 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and DellAngelica, 2004 [PubMed 15102850]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.08 kDa |
AA Sequence : | ATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAP |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLOC1S1 biogenesis of lysosomal organelles complex-1, subunit 1 [ Homo sapiens ] |
Official Symbol | BLOC1S1 |
Synonyms | RT14; BLOS1; MICoA; GCN5L1 |
Gene ID | 2647 |
mRNA Refseq | NM_001487.3 |
Protein Refseq | NP_001478.2 |
MIM | 601444 |
UniProt ID | P78537 |
◆ Recombinant Proteins | ||
BLOC1S1-2418M | Recombinant Mouse BLOC1S1 Protein | +Inquiry |
BLOC1S1-247H | Recombinant Human BLOC1S1 Protein, GST-tagged | +Inquiry |
BLOC1S1-1710HF | Recombinant Full Length Human BLOC1S1 Protein, GST-tagged | +Inquiry |
Bloc1s1-1872M | Recombinant Mouse Bloc1s1 Protein, Myc/DDK-tagged | +Inquiry |
BLOC1S1-1043M | Recombinant Mouse BLOC1S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLOC1S1-8444HCL | Recombinant Human BLOC1S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLOC1S1 Products
Required fields are marked with *
My Review for All BLOC1S1 Products
Required fields are marked with *