Recombinant Human BLVRA protein, GST-tagged
Cat.No. : | BLVRA-10242H |
Product Overview : | Recombinant Human BLVRA protein(1-296 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-296 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | BLVRA biliverdin reductase A [ Homo sapiens ] |
Official Symbol | BLVRA |
Synonyms | BLVRA; biliverdin reductase A; BLVR; BVR A; biliverdin-IX alpha-reductase; BVR; BVRA; |
mRNA Refseq | NM_000712 |
Protein Refseq | NP_000703 |
MIM | 109750 |
UniProt ID | P53004 |
Gene ID | 644 |
◆ Recombinant Proteins | ||
Blvra-595R | Recombinant Rat Biliverdin Reductase A | +Inquiry |
Blvra-434M | Recombinant Mouse Blvra Protein, MYC/DDK-tagged | +Inquiry |
BLVRA-1643H | Recombinant Human BLVRA protein, His-tagged | +Inquiry |
Blvra-1688R | Recombinant Rat Blvra protein, His & T7-tagged | +Inquiry |
BLVRA-373R | Recombinant Rhesus Macaque BLVRA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLVRA-8441HCL | Recombinant Human BLVRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLVRA Products
Required fields are marked with *
My Review for All BLVRA Products
Required fields are marked with *