Recombinant Human BLVRB Protein, GST-tagged
| Cat.No. : | BLVRB-251H |
| Product Overview : | Human BLVRB partial ORF ( NP_000704, 107 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24). |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BLVRB biliverdin reductase B (flavin reductase (NADPH)) [ Homo sapiens ] |
| Official Symbol | BLVRB |
| Synonyms | BLVRB; biliverdin reductase B (flavin reductase (NADPH)); Flavin reductase , FLR; flavin reductase (NADPH); SDR43U1; short chain dehydrogenase/reductase family 43U; member 1; FR; GHBP; BVR-B; NADPH-flavin reductase; NADPH-dependent diaphorase; green heme-binding protein; biliverdin-IX beta-reductase; short chain dehydrogenase/reductase family 43U, member 1; FLR; BVRB; MGC117413; |
| Gene ID | 645 |
| mRNA Refseq | NM_000713 |
| Protein Refseq | NP_000704 |
| MIM | 600941 |
| UniProt ID | P30043 |
| ◆ Recombinant Proteins | ||
| BLVRB-27485TH | Recombinant Human BLVRB | +Inquiry |
| BLVRB-07H | Active Recombinant Full Length Human BLVRB Protein | +Inquiry |
| BLVRB-2498H | Recombinant Human BLVRB protein, His-tagged | +Inquiry |
| BLVRB-1713HF | Recombinant Full Length Human BLVRB Protein, GST-tagged | +Inquiry |
| BLVRB-135H | Recombinant Human Biliverdin Reductase B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BLVRB-8440HCL | Recombinant Human BLVRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLVRB Products
Required fields are marked with *
My Review for All BLVRB Products
Required fields are marked with *
