Recombinant Human BMF protein, His-tagged
Cat.No. : | BMF-5644H |
Product Overview : | Recombinant Human BMF protein(), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BMF Bcl2 modifying factor [ Homo sapiens ] |
Official Symbol | BMF |
Synonyms | BMF; Bcl2 modifying factor; bcl-2-modifying factor; FLJ00065; |
Gene ID | 90427 |
mRNA Refseq | NM_001003940 |
Protein Refseq | NP_001003940 |
MIM | 606266 |
UniProt ID | Q96LC9 |
◆ Recombinant Proteins | ||
BMF-3802C | Recombinant Chicken BMF | +Inquiry |
BMF-27487TH | Recombinant Human BMF, T7 -tagged | +Inquiry |
BMF-0768H | Recombinant Human BMF Protein (Met1-Ala181), N-His tagged | +Inquiry |
BMF-1721HF | Recombinant Full Length Human BMF Protein, GST-tagged | +Inquiry |
Bmf-1879M | Recombinant Mouse Bmf Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMF-8438HCL | Recombinant Human BMF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMF Products
Required fields are marked with *
My Review for All BMF Products
Required fields are marked with *