Recombinant Human BMF protein, His-tagged
| Cat.No. : | BMF-5644H | 
| Product Overview : | Recombinant Human BMF protein(), fused with N-terminal His tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. | 
| AASequence : | MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQ | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | BMF Bcl2 modifying factor [ Homo sapiens ] | 
| Official Symbol | BMF | 
| Synonyms | BMF; Bcl2 modifying factor; bcl-2-modifying factor; FLJ00065; | 
| Gene ID | 90427 | 
| mRNA Refseq | NM_001003940 | 
| Protein Refseq | NP_001003940 | 
| MIM | 606266 | 
| UniProt ID | Q96LC9 | 
| ◆ Recombinant Proteins | ||
| BMF-3802C | Recombinant Chicken BMF | +Inquiry | 
| BMF-27487TH | Recombinant Human BMF, T7 -tagged | +Inquiry | 
| BMF-0768H | Recombinant Human BMF Protein (Met1-Ala181), N-His tagged | +Inquiry | 
| BMF-1721HF | Recombinant Full Length Human BMF Protein, GST-tagged | +Inquiry | 
| Bmf-1879M | Recombinant Mouse Bmf Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BMF-8438HCL | Recombinant Human BMF 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMF Products
Required fields are marked with *
My Review for All BMF Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            