Recombinant Human BMI1 protein(101-170 aa), C-His-tagged
| Cat.No. : | BMI1-2733H |
| Product Overview : | Recombinant Human BMI1 protein(P35226)(101-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101-170 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | HPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAM |
| Gene Name | BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ] |
| Official Symbol | BMI1 |
| Synonyms | BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse) , PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog; PCGF4; FLVI2/BMI1; MGC12685; |
| Gene ID | 648 |
| mRNA Refseq | NM_005180 |
| Protein Refseq | NP_005171 |
| MIM | 164831 |
| UniProt ID | P35226 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMI1 Products
Required fields are marked with *
My Review for All BMI1 Products
Required fields are marked with *



