Recombinant Human BMP10 Protein
Cat.No. : | BMP10-486H |
Product Overview : | Recombinant Human BMP10 was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | THis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of tHis family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which binds to the activin receptor-like kinase 1 (ALK1) and plays important roles in cardiovascular development including cardiomyocyte proliferation and regulation of heart size, closure of the ductus arteriosus, angiogenesis and ventricular trabeculation. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Molecular Mass : | 24.4 kDa |
AA Sequence : | NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | BMP10 bone morphogenetic protein 10 [ Homo sapiens ] |
Official Symbol | BMP10 |
Synonyms | BMP10; bone morphogenetic protein 10; MGC126783; |
Gene ID | 27302 |
mRNA Refseq | NM_014482 |
Protein Refseq | NP_055297 |
MIM | 608748 |
UniProt ID | O95393 |
◆ Recombinant Proteins | ||
BMP10-2429M | Recombinant Mouse BMP10 Protein | +Inquiry |
BMP10-5327C | Recombinant Chicken BMP10 | +Inquiry |
BMP10-0771H | Recombinant Human BMP10 Protein (Arg315-Arg424), N-GST tagged | +Inquiry |
BMP10-7083Z | Recombinant Zebrafish BMP10 | +Inquiry |
BMP10-486H | Recombinant Human BMP10 Protein | +Inquiry |
◆ Native Proteins | ||
BMP10-999R | Recombinant Rat BMP10 Protein, His tagged | +Inquiry |
BMP10-995R | Recombinant Rat BMP10 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP10-8435HCL | Recombinant Human BMP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP10 Products
Required fields are marked with *
My Review for All BMP10 Products
Required fields are marked with *