Recombinant Human BMP10 Protein

• Cat.No.: BMP10-486H
• Product Overview: Recombinant Human BMP10 was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Description: THis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of tHis family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which binds to the activin receptor-like kinase 1 (ALK1) and plays important roles in cardiovascular development including cardiomyocyte proliferation and regulation of heart size, closure of the ductus arteriosus, angiogenesis and ventricular trabeculation.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Molecular Mass: 24.4 kDa
• AA Sequence: NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: BMP10 bone morphogenetic protein 10 [ Homo sapiens ]
• Official Symbol: BMP10
• Synonyms: BMP10; bone morphogenetic protein 10; MGC126783
• Gene ID: 27302
• mRNA Refseq: NM_014482
• Protein Refseq: NP_055297
• MIM: 608748
• UniProt ID: O95393