Recombinant Human BMP2 protein, GST-tagged
Cat.No. : | BMP2-6745H |
Product Overview : | Recombinant Human BMP2 protein(27-102 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 27-102 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | ELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERA |
Gene Name | BMP2 bone morphogenetic protein 2 [ Homo sapiens ] |
Official Symbol | BMP2 |
Synonyms | BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2; |
Gene ID | 650 |
mRNA Refseq | NM_001200 |
Protein Refseq | NP_001191 |
MIM | 112261 |
UniProt ID | P12643 |
◆ Recombinant Proteins | ||
BMP2-56H | Active Recombinant Human BMP2, HIgG1 Fc-tagged, mutant | +Inquiry |
BMP2-567C | Recombinant Cattle BMP2 protein, His-tagged | +Inquiry |
Bmp2-212R | Recombinant Rat Bmp2 protein, His/S-tagged | +Inquiry |
BMP2-03H | Active Recombinant Human BMP2 Protein, Animal Free | +Inquiry |
BMP2-5352H | Recombinant Human BMP2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP2-3075HCL | Recombinant Human BMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2 Products
Required fields are marked with *
My Review for All BMP2 Products
Required fields are marked with *